PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.168
Common NameAMTR_s00021p00200760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ARF
Protein Properties Length: 826aa    MW: 90952.1 Da    PI: 6.2923
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.168genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.5e-24132233199
                                               EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-T CS
                                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltk 63 
                                               f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+
  evm_27.model.AmTr_v1.0_scaffold00021.168 132 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGFEWKFRHIYRGQPRRHLLTT 199
                                               99****************************963.3445679**************************** PP

                                               THHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                                        B3  64 GWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                                               GW+ Fv++++L +gD v+F   + +++el+++++r+
  evm_27.model.AmTr_v1.0_scaffold00021.168 200 GWSVFVNQKKLVAGDAVLFL--RGESGELRLGIRRA 233
                                               ********************..449999*****996 PP

2Auxin_resp119.52.6e-39260340282
                                Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdld 70 
                                               ++a+stksvF+v YnPras++eF+v+++k+ k +++++s+GmRfkm++eted++err++G+++gv d+d
  evm_27.model.AmTr_v1.0_scaffold00021.168 260 SKAVSTKSVFHVSYNPRASPAEFIVPYWKYYKNFNQQFSLGMRFKMKIETEDAAERRCTGLISGVGDID 328
                                               789****************************************************************** PP

                                Auxin_resp  71 pvrWpnSkWrsL 82 
                                               pvrWp+SkWr+L
  evm_27.model.AmTr_v1.0_scaffold00021.168 329 PVRWPGSKWRCL 340
                                               ***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.01E-43126238IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.8E-40128237IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-22130232No hitNo description
PfamPF023621.2E-22132233IPR003340B3 DNA binding domain
SMARTSM010195.4E-25132234IPR003340B3 DNA binding domain
PROSITE profilePS5086313.028132234IPR003340B3 DNA binding domain
PfamPF065071.9E-35260340IPR010525Auxin response factor
PROSITE profilePS5174517.697702785IPR000270PB1 domain
SuperFamilySSF542771.32E-5703763No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MGIDLNRRVT AEGHAPRAEE GAAGTVCLEV WQACAGSLIS LPRKGSVVVY FAQGHLEQAG  60
ASCDGWGLPP QVFCRVINVN LHADQVSDEV YAQVSLTPIP EPVEKGLPEE EVREDGEEEF  120
EFVSRSATPH MFCKTLTASD TSTHGGFSVP RRAAEDCFPP LDYKQQRPSQ ELVAKDLHGF  180
EWKFRHIYRG QPRRHLLTTG WSVFVNQKKL VAGDAVLFLR GESGELRLGI RRAGRPRGGS  240
VPSLALLSQN LSGSTFAAVS KAVSTKSVFH VSYNPRASPA EFIVPYWKYY KNFNQQFSLG  300
MRFKMKIETE DAAERRCTGL ISGVGDIDPV RWPGSKWRCL MVRWDEDSGN DRLDRVSPWE  360
IDLLGSVPVF SPPATGLKRP RISLPSIQTG CSPPDGSTFS DFGESVRFHK VLQGQEKSGF  420
SKPYDSSSHQ LLESRRFIPS INSPMSSEFV RGAIQTPLGV GPFISSSNSI GFEESDRFHK  480
VLQGQEIFHL KSQNNRERNS ELSVGTLEGY PIPITGERWS VLPLQGHPAQ FPLSPSTPRF  540
PTPSLLRFHG SGSHLLHPPL VPQDINNTLR IAEQPSGNFS LLACGEVSKG PLNESPCDSL  600
KKKSQAPDVC APPTDAFRVD IKDGKDGATN ARNSCCRLFG FSLTEEPPLS NEAMDPAHVS  660
LSSNDDFNSK SSFQPSTWTV SCETQQKQSE SKSQCLNKTA NRSCTKVHKQ GSMVGRAINL  720
SKFEGYDDLI SELERLFNME GLLNDPKKGW QVVYTDSDDD MMLILIYTHD EVEKMIPVVV  780
ASDDAQSCSE EAPTTTTEAS KSSCGPQDSL HQWSEHESDG LARAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1112936254388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN2633640.0FN263364.1 Amborella trichopoda mRNA for ETTIN protein (ETT gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626290.10.0PREDICTED: auxin response factor 3
TrEMBLW1Q0G90.0W1Q0G9_AMBTC; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-180auxin response factor 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]